2.43 Rating by CuteStat

puntlandpost.com is 1 decade 2 years old. It has a global traffic rank of #416,263 in the world. It is a domain having .com extension. This website is estimated worth of $ 5,760.00 and have a daily income of around $ 16.00. As no active threats were reported recently by users, puntlandpost.com is SAFE to browse.

Display Domain Stats or Pagerank Widget for this domain on your website. Click Here
Get Widget Code
Google Pagerank
PR 0 out of 10
PageSpeed Score
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: 1,734
Daily Pageviews: 5,202

Estimated Valuation

Income Per Day: $ 16.00
Estimated Worth: $ 5,760.00

Search Engine Indexes

Google Indexed Pages: 6,010
Yahoo Indexed Pages: 2
Bing Indexed Pages: 2

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: 1
Alexa BackLinks: 213

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Very Poor
WOT Privacy: Very Poor
WOT Child Safety: Very Poor

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: 416,263
Domain Authority: 46 ON 100
DMOZ Listing: No

Web Server Information

Hosted IP Address:

Hosted Country:

United States US

Location Latitude:


Location Longitude:

Puntlandpost.com - All About Somalia and Puntland

Page Resources Breakdown

Homepage Links Analysis

Social Engagement

Facebook Shares: 37
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): 5
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable
Google+: Not Applicable

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: Not Applicable
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e.

Lambodar Sahu

- lambodarsahu.com

Lambodar Sahu: The Miscellaneous Ramblings of an Average Guy

  529,315   $ 1,440.00


- e94.org

E94: Tips, Advice and Reviews

  12,540,162   $ 8.95

Index of /

- onlinemarketingreviewsandtips.com

  1,528,854   $ 480.00


- vlr.co

Its a Vlr.co

  2,651,232   $ 240.00


- usads.biz

Usads: Articles, Reviews, Tips and Advices

  2,314,641   $ 240.00

Domain Information

Domain Registrar: ENOM, INC.
Registration Date: 2001-12-11 1 decade 2 years 9 months ago
Last Modified: 2012-11-11 1 year 10 months 1 week ago
Expiration Date: 2013-12-11 9 months 4 days 15 hours ago

Similarly Ranked Websites

Newborn & Infant Clothing - The Official Online Store for Little Me...

- littleme.com

Little Me sells unique, stylish & cool newborn and infant clothing. Shop for precious girls and boys baby clothes at fantastic prices!

  416,264   $ 5,760.00


- megaconstrucciones.net

Información sobre construcciones emblemáticas de todo el mundo, con numerosas fotos y vídeos

  416,265   $ 5,760.00

Strona Główna

- compensa.pl

Host your images for free

  416,266   $ 5,760.00

Оформление заказа

- simpleopencart.com

  416,266   $ 5,760.00

www.hansa.com - HANSA

- hansa.com

  416,268   $ 5,760.00

Alexa Traffic Rank

Alexa Search Engine Traffic

Comments / Ratings / Reviews / Feedbacks for puntlandpost.com