2.43 Rating by CuteStat

puntlandpost.com is 1 decade 5 years old. It has a global traffic rank of #416,263 in the world. It is a domain having .com extension. This site has a Google PageRank of 5/10. This website is estimated worth of $ 5,760.00 and have a daily income of around $ 16.00. As no active threats were reported recently by users, puntlandpost.com is SAFE to browse.

Display Domain Stats or Pagerank Widget for this domain on your website. Click Here
Google Pagerank
PR 5 out of 10
PageSpeed Score
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: 1,734
Daily Pageviews: 5,202

Estimated Valuation

Income Per Day: $ 16.00
Estimated Worth: $ 5,760.00

Search Engine Indexes

Google Indexed Pages: 6,010
Yahoo Indexed Pages: 2
Bing Indexed Pages: 2

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: 1
Alexa BackLinks: 213

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Privacy: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank:
Alexa Rank: 416,263
Domain Authority: 46 ON 100
DMOZ Listing: No

Web Server Information

Hosted IP Address:

Hosted Country:

United States US

Location Latitude:


Location Longitude:

Puntlandpost.com - All About Somalia and Puntland

Page Resources Breakdown

Homepage Links Analysis

Social Engagement

Facebook Shares: 37
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): 5
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable
Google+: Not Applicable

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: Not Applicable
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e.

Lambodar Sahu

- lambodarsahu.com

Lambodar Sahu: The Miscellaneous Ramblings of an Average Guy

  529,315   $ 1,440.00


- e94.org

E94: Tips, Advice and Reviews

  12,540,162   $ 8.95

Index of /

- onlinemarketingreviewsandtips.com

  1,528,854   $ 480.00


- vlr.co

Its a Vlr.co

  2,651,232   $ 240.00


- usads.biz

Usads: Articles, Reviews, Tips and Advices

  2,314,641   $ 240.00

Domain Information

Domain Registrar: ENOM, INC.
Registration Date: 2001-12-11 1 decade 5 years 9 months ago
Last Modified: 2012-11-11 4 years 10 months 4 days ago
Expiration Date: 2013-12-11 3 years 9 months 1 week ago

Domain Nameserver Information

Host IP Address Country
ns827.hostgator.com United States United States
ns828.hostgator.com United States United States

Similarly Ranked Websites

Newborn & Infant Clothing - The Official Online Store for Little Me...

- littleme.com

Little Me sells unique, stylish & cool newborn and infant clothing. Shop for precious girls and boys baby clothes at fantastic prices!

  416,264   $ 5,760.00


- megaconstrucciones.net

Información sobre construcciones emblemáticas de todo el mundo, con numerosas fotos y vídeos

  416,265   $ 5,760.00

Strona Główna

- compensa.pl

Host your images for free

  416,266   $ 5,760.00

Property in Pune | Real Estate in Pune | Fourrwalls.com

- fourrwalls.com

Search Pune real estate properties, buy Best Residential Properties/ apartments in Pune,Pune property, property in Pune, purchase New Flats,flats for sale in pune, and...

  416,267   $ 5,760.00

www.hansa.com - HANSA

- hansa.com

  416,268   $ 5,760.00

Alexa Traffic Rank

Alexa Search Engine Traffic

Comments / Ratings / Reviews / Feedbacks for puntlandpost.com